Glycan Array Experiment: primscreen_PA_v1_132_07052005

Glycan Array ID : primscreen_PA_v1_132_07052005
Sample Name : Dectin-2
Sample Category : C Type Lectins
Investigator: : Phil Taylor
Download Data:
File: Dectin-2-Fc-PT-21967-Alexa488_070505_1605 PA Result.xls
Conclusive
Sample Information:
Name : Dectin-2
Complete Name : Dectin-2, C-type lectin domain family 6 member A, C-type lectin superfamily member 10, Clec6a, Dendritic cell-associated lectin 2, DC-associated C-type lectin-2
Family : C-Type Lectin
Sub Family : 2-Type 2 Receptor
Gene Symbol : Clec4n
Synonyms : Information not entered/not applicable.
Species Common Name: : Mouse
Species Scientific Name : Mus musculus
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-10-17
Status : Public
Primary Sequence :
MVQERQSQGKGVCWTLRLWSAAVISMLLLSTCFIASCVVTYQFIMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Information not entered/not applicable.
External References :
Genbank : BC023008
Swissprot : Q9JKF4
Experiment Information:
Status: : Public
Title/Project Description: : The investigator wishes to determine the carbohydrate-binding specificity of murine Dectin-2.
Associated Resource Requests: : cfg_rRequest_278
Glycan Array Version: : PA_v1
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2005-07-01
Supplying Investigator : Phil Taylor
Specific Assay Information : Dectin-2-Fc was screened against the printed array using Goat anti-human IgG-488..The concentration of Dectin-2-Fc used was 200ug/ml. The concentration of Goat anti-human IgG-488 used was 10ug/ml..Storage: -20C
Annotation : Information not entered/not applicable.
Protein Sample Analyzed : Dectin-2