Glycan Array Experiment: primscreen_PA_v2_230_02102006

Glycan Array ID : primscreen_PA_v2_230_02102006
Sample Name : PA-IIL
Sample Category : Other
Investigator: : Anne Imberty
Download Data:
File: PA-IIL PA Results.xls
Conclusive
Sample Information:
Name : PA-IIL
Complete Name : Information not entered/not applicable.
Family : Viral / Bacterial Lectin
Sub Family : Bacterial Lectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Pseudomonas aeruginosa
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2006-02-13
Status : Public
Primary Sequence :
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Bacteria
External References :
Genbank : PA3361
Experiment Information:
Status: : Public
Title/Project Description: : Glycan array screening of a set of soluble lectins from opportunistic bacteria
Associated Resource Requests: : cfg_rRequest_458
Glycan Array Version: : PA_v2
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2006-02-03
Supplying Investigator : Anne Imberty
Specific Assay Information : PA-IIL was labeled with Alexa 488 prior to arrival and screening on the printed array v2.The concentration of PA-IIL used was 200ug/ml..Storage: 4C
Annotation : Information not entered/not applicable.
Protein Sample Analyzed : PA-IIL