Glycan Array Experiment: primscreen_910

Glycan Array ID : primscreen_910
Sample Name : Siglec-6
Sample Category : I Type Lectins
Investigator: : Bruce S. Bochner
Download Data:
File: Human Siglec-6 Alexa488_062306 Data.xls
Conclusive
Sample Information:
Name : Siglec-6
Complete Name : Sialic acid binding Ig-like lectin 6 [Precursor], Siglec-6, Obesity-binding protein 1, OB-BP1, CD33 antigen-like 1
Family : Siglec
Sub Family : Siglec
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-05-24
Status : Public
Primary Sequence :
MLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Comments :
Information not entered/not applicable.
Known Sites of Expression :
placenta ;placenta_normal ;pooled ;pooled brain, lung, testis
External References :
Genbank : D86358
Omim_Parse_Links : 604405
Swissprot : O43699
Omim : 604405
Experiment Information:
Status: : Public
Title/Project Description: : Request is for glycan array slides to test freshly isolated transfected and normal human leukocyte subtypes expressing various forms of Siglec-8.
Associated Resource Requests: : cfg_rRequest_413
Glycan Array Version: : PA_v2
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2006-06-22
Supplying Investigator : Bruce S. Bochner
Specific Assay Information : Human Siglec 6 (RhSiglec-6/Fc Chimera from R&D Systems, catalog # 2859-SL, Lot # NXK015061) was assayed in standard binding buffer (TSM, 1 percent BSA, 0.05 percent Tween 20) at a concentration of 200 ug/ml. The slide (70 microliters under a cover slip) was incubated for one hour in a dark humidified chamber. A secondary incubation was performed to with anti-Human IgG AlexaFlour 488 at 5 micrograms/ml, diluted in standard binding buffer and incubated for one hour in a dark humidified chamber.
Annotation : not Siglec-8
Protein Sample Analyzed : Siglec-6