Glycan Array Experiment: primscreen_1655

Glycan Array ID : primscreen_1655
Sample Name : E-selectin
Sample Category : C Type Lectins
Investigator: : Richard D. Cummings
Download Data:
File: Human E Selectin_2ug.ml_37432_DATA.xls
Conclusive
Sample Information:
Name : E-selectin
Complete Name : Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen
Family : C-Type Lectin
Sub Family : 4-Selectin
Gene Symbol : SELE
Synonyms : Leukocyte endothelial cell adhesion molecule 2
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-05-21
Status : Public
Primary Sequence :
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Hypothalamus ;human skeletal muscle ;Chondrosarcoma ;tonsil ;corresponding non cancerous liver tissue ;uterus ;carcinoid ;breast ;endothelial ;leiomyosarcoma ;parathyroid tumor ;heart ;umbilical vein
External References :
Genbank : AL021940
Omim_Parse_Links : 131210
Pdb : 1ESL
Pdb : 1G1T
Pdb : 1KJA
Swissprot : P16581
Omim : 131210
Experiment Information:
Status: : Public
Title/Project Description: : To determine the fine specificity of P-Selectin-Ig chimera (mouse and human), L-Selectin-Ig chimera (mouse and human), E-Selectin-Ig Chimera (mouse and human).
Associated Resource Requests: : cfg_rRequest_979
Glycan Array Version: : PA_v3
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2007-08-29
Supplying Investigator : Richard D. Cummings
Specific Assay Information : Human E-Selectin was assayed on the slide array at 2ug/ml. The dilution was made in our standard binding buffer (TSM, 1 percent BSA and 0.05 percent Tween 20). 70 microlitres was incubated on the array under a coverslip in a dark humidified chamber for one hour. A secondary incubation was performed with anti-Human IgG Alexa 488 at 5 ug/ml under the same conditions as previously described.
Annotation : Human E-Selectin (2ug/ml)
Protein Sample Analyzed : E-selectin