Glycan Array Experiment: primscreen_1979

Glycan Array ID : primscreen_1979
Sample Name : BabA 235 FAdhesin binding fucosylated histo-blood group antigen,
Sample Category : Other
Investigator: : Lars-Oliver Essen
Download Data:
File: Bab A 235 _200ug.mL _ pH 2.5_ 2 Hours_ 5985_DATA.xls
Conclusive
Sample Information:
Name : BabA 235 FAdhesin binding fucosylated histo-blood group antigen,
Complete Name : Omp28
Family : Other
Sub Family : Adhesin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Helicobacter pylori
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Sugar binding domain only
Entry Date [yyyy-mm-dd] : 2008-04-17
Status : Public
Primary Sequence :
AEDDGFYMSAGYQIGEAAQMVKNTKGIQELSDNYENLSNLLTRYSTLNTLIKLSADPSAVNAARENLGASAKNLIGDTKNSPAYQAVLLAINAAVGFWNVVGYVTQCGGNANGQKSTSSTTIFNNEPGYRSTSITCSLNGHMPGYYGPMSIENFKKLNEAYQILQTALKNGLPALKENNGTVNVTYSYTCSGEGNDNCSLQTTGVTNQNNGTKTETQTIDGKSVTTTISSKVVDSQ
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Expressed in E. coli in inclusion bodies
External References :
Swissprot : O52269_HELPY
Genbank : HPAG1_0876
Experiment Information:
Status: : Public
Title/Project Description: : Analysis to identify suitable ligands for the crystallization and structural determination of the Flo5 and Flo11 proteins and BabA adhesion
Associated Resource Requests: : cfg_rRequest_1224
Glycan Array Version: : PA_v31
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2008-02-26
Supplying Investigator : Lars-Oliver Essen
Specific Assay Information : BabA adhesin at pH 2.5 was diluted to 200 micrograms/mL in buffer (10mM KPO4, 200mM NaCl, 2mM MgCl2, 2mM CaCl2). Seventy microliters was applied to the printed surface of the array, coverslipped, and incubated at room temperature in a humidified chamber away from light for two hours. The coverslip was removed and the slide rinsed 4 times in TSM washing buffer containing Tween and 4 times in TSM buffer without Tween. Seventy microliters of anti-His antibody labeled with Alexa488 at 5ug/ml (Qiagen) was added to the slide for one hour at room temperature in a humidified chamber away from light followed by wash steps.
Annotation : Adhesin binding fucosylated histo-blood group antigen assayed at pH 2.5
Protein Sample Analyzed : BabA 235 FAdhesin binding fucosylated histo-blood group antigen,