Glycan Array Experiment: primscreen_2106

Glycan Array ID : primscreen_2106
Sample Name : Collectin K1
Sample Category : C Type Lectins
Investigator: : Nobutaka Wakamiya
Download Data:
File: CL-K1_Ca_6772_v3.1_DATA.xls
Conclusive
Sample Information:
Name : Collectin K1
Complete Name : Collectin-K1, Collectin sub-family member 11, RGNL596, COLEC11
Family : C-Type Lectin
Sub Family : 3-Collectin
Gene Symbol : COLEC11
Synonyms : Information not entered/not applicable.
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-05-21
Status : Public
Primary Sequence :
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Comments :
Information not entered/not applicable.
Known Sites of Expression :
neuroblastoma ;kidney ;serous adenocarcinoma ;breast ;corresponding non cancerous liver tissue ;hepatocellular carcinoma ;fibrotheoma ;neuroblastoma cells ;ovary (pool of 3) ;fetal eyes, lens, eye anterior segment, optic nerve, retina, Retina Foveal and Macular, RPE and Choroid ;mixed ;neuroblastoma, cell line ;ovary ;prostate ;Pooled human melanocyte, fetal heart, and pregnant uterus ;germ cell tumor ;kidney tumor ;pooled germ cell tumors
External References :
Genbank : AC010907
Swissprot : Q9BWP8
Experiment Information:
Status: : Public
Title/Project Description: : To continued the studies of human collectin CL-K1 see cfg_rRequest_1194.
Associated Resource Requests: : cfg_rRequest_1351
Glycan Array Version: : PA_v31
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 200 μg/ml
Experiment Date [yyyy-mm-dd]: : 2008-05-28
Supplying Investigator : Nobutaka Wakamiya
Specific Assay Information : Human Collectin CL-K1 directly labeled with Alexa-488 was diluted to 200 micrograms/mL in high calcium binding buffer (TSM with 10mM CaCl2, 1 percent BSA and 0.05 percent Tween 20). Seventy microliters was applied to the printed surface of the array, coverslipped, and incubated at room temperature in a humidified chamber away from light for one hour, followed by wash steps.
Annotation : Human Collectin CL-K1 + Ca2+
Protein Sample Analyzed : Collectin K1