Glycan Array Experiment: primscreen_2160

Glycan Array ID : primscreen_2160
Sample Name : Langerin ectodomain (P830)
Sample Category : C Type Lectins
Investigator: : Gerard Zurawski
Download Data:
File: Langerin_10ug_ 6118_DATA.xls
Conclusive
Sample Information:
Name : Langerin ectodomain (P830)
Complete Name : Langerin, CLEC4K
Family : C-Type Lectin
Sub Family : C-type Lectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Homo Sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2007-12-19
Status : Public
Primary Sequence :
LDYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEPVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Transiently transfected 293F cells
External References :
Swissprot : CLC4K_HUMAN
Genbank : AJ242859.1 GI:6523278|
Experiment Information:
Status: : Public
Title/Project Description: : Glycoarray analysis of ectodomain IgGFc fusion proteins 334998 and 335774 to define which glycans have the highest affinity
Associated Resource Requests: : cfg_rRequest_1244
Glycan Array Version: : PA_v31
Protocol Used: : Printed Array Screening
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 10 μg/ml
Experiment Date [yyyy-mm-dd]: : 2008-03-21
Supplying Investigator : Gerard Zurawski
Specific Assay Information : Langerin was diluted to 10 micrograms/mL in PBS binding buffer (PBS, 1 percent BSA and 0.05 percent Tween 20). Seventy microliters was applied to the printed surface of the array, coverslipped, and incubated at room temperature in a humidified chamber away from light for one hour. The coverslip was removed and the slide rinsed 4 times in PBS washing buffer containing Tween and 4 times in PBS buffer without Tween. Seventy microliters of PE-labeled goat anti-human Fc gamma (5 ug/ml, provided by PI) in PBS binding buffer was added to the slide for one hour at room temperature in a humidified chamber away from light. Washes were performed as above.
Annotation : Langerin 10ug/ml
Protein Sample Analyzed : Langerin ectodomain (P830)