Glycan Array Experiment: primscreen_2539

Glycan Array ID : primscreen_2539
Sample Name : Langerin
Sample Category : C Type Lectins
Investigator: : Maureen E. Taylor
Download Data:
File: Human Langerin_9169_V3.2_DATA.xls
Conclusive
Sample Information:
Name : Langerin
Complete Name : C-type lectin domain family 4 member K, CD207 antigen, Langerhans cell specific C-type lectin
Family : C-Type Lectin
Sub Family : 2-Type 2 Receptor
Gene Symbol : CD207
Synonyms : Langerin
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-10-17
Status : Public
Primary Sequence :
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Comments :
Information not entered/not applicable.
Known Sites of Expression :
bladder_tumor ;skin ;lung ;prostate
External References :
Swissprot : Q9UJ71
Genbank : NM_015717
Omim_Parse_Links : 604862
Omim : 604862
Experiment Information:
Status: : Public
Title/Project Description: : To confirm the outcome of little langerin, a truncated but still trimeric and very soluble form of this receptor from skin dendritic cells from a plate array with the alternative presentation on the printed array.
Associated Resource Requests: : cfg_rRequest_1578
Glycan Array Version: : PA_v32
Protocol Used: : Protocol Direct Binding
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 200 μg/ml
Experiment Date [yyyy-mm-dd]: : 2026-09-12
Supplying Investigator : Maureen E. Taylor
Specific Assay Information : Direct binding protocol used- samples was FITC labeled. Calcium chloride was added to 25 mM to binding buffer.
Annotation : Langerin, little 200 ug/ml
Protein Sample Analyzed : Langerin