Glycan Array Experiment: primscreen_3268

Glycan Array ID : primscreen_3268
Sample Name : FimH
Sample Category : Other
Investigator: : Lode Wyns
Download Data:
File: FimH-1ug_12911_v4.1_DATA.xls
Conclusive
Sample Information:
Name : FimH
Complete Name : minor component of type 1 fimbriae
Family : Viral / Bacterial Lectin
Sub Family : I-type lectin, 2-domain fimbrial adhesin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : E. coli
Estimated Purity : 95%
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2010-07-27
Status : Private
Primary Sequence :
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Comments :
Co-crystal structures with specific glycans, SPR, BSI, ITC
Known Sites of Expression :
E. coli, Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin. Bouckaert J, Berglund J, Schembri M, De Genst E, Cools L, Wuhrer M, Hung CS, Pinkner J, Slättegård R, Zavialov A, Choudhury D, Langermann S, Hultgren SJ, Wyns L, Klemm P, Oscarson S, Knight SD, De Greve H. Mol Microbiol. 2005 Jan;55(2):441-55.
External References :
Swissprot : P08191
Genbank : 948847
Experiment Information:
Status: : Public
Title/Project Description: : Continued studies - to sample more broadly examine the extent of the specificity of FimH-glycan receptor interaction, because the latter receptor(s) are constitutively or incidentally present on a much wide range of cell types.
Associated Resource Requests: : cfg_rRequest_1952
Glycan Array Version: : PA_v41
Protocol Used: : Protocol Tertiary step
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 1 μg/ml
Experiment Date [yyyy-mm-dd]: : 2010-05-26
Supplying Investigator : Lode Wyns
Specific Assay Information : Sample was diluted in 20 mM Tris-HCl pH 7.4, 150 mM NaCl, 1mM EDTA, 1% BSA, Tween 20 at 0.05%. Sample was detected with anti-FimH antibody (sent by PI, 1:131 dilution), followed by detection with fluorescently labeled anti-rabbit IgG.
Annotation : FimH type 1 fimbriae-1
Protein Sample Analyzed : FimH