Glycan Array Experiment: primscreen_3380

Glycan Array ID : primscreen_3380
Sample Name : PA1L
Sample Category : Other
Investigator: : Anne Imberty
Download Data:
File: PA-IL_12862_v4.1_DATA.xls
Conclusive
Sample Information:
Name : PA1L
Complete Name : PA-I galactophilic lectin
Family : Viral / Bacterial Lectin
Sub Family : Calcium binding lectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Pseudomonas aeruginosa
Estimated Purity : Pure
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2010-08-20
Status : Private
Primary Sequence :
MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Comments :
Hemagglutination inhibition assay
Known Sites of Expression :
Recombinant in E. coli, Blanchard et al., 2008 ; Gilboa-Garber et al., 1982
External References :
Swissprot : Q05097
Genbank : 4385414
Experiment Information:
Status: : Public
Title/Project Description: : To examine the glycan-specificity of these bacterial lectin, Chromobacterium violaceum, Burkholderia cenocepacia, and Ralstonia solanacearum on the most recent version of the array
Associated Resource Requests: : cfg_rRequest_2058
Glycan Array Version: : PA_v41
Protocol Used: : Protocol Direct Binding
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 1 μg/ml
Experiment Date [yyyy-mm-dd]: : 2010-05-26
Supplying Investigator : Anne Imberty
Specific Assay Information : Samples were directly labeled with AlexaFluor 488.
Annotation : PA-1L-1
Protein Sample Analyzed : PA1L