Glycan Array Experiment: primscreen_3716

Glycan Array ID : primscreen_3716
Sample Name : Influenza A virus A/Memphis/7/1980 H1N1
Sample Category : Other
Investigator: : Peter P.J.M Rottier
Download Data:
File: Memphis_13374_v4.2_DATA.xls
Conclusive
Sample Information:
Name : Influenza A virus A/Memphis/7/1980 H1N1
Complete Name : Hemagglutinin serotype 1
Family : Viral / Bacterial Lectin
Sub Family : Hemagglutinin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Information not entered/not applicable.
Estimated Purity : 95%
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2011-03-06
Status : Private
Primary Sequence :
mkakllvllcalsatdadticigyhannstdtvdtvleknvtvthsvnlledshngklcr61lkgiaplqlgkcsiagwilgnpeceslfskkswsyiaetpnsengtcypgyfadyeelre121qlssvssferfeifpkesswpkhnvtrgvtascshkgkssfyrnllwltekngsypnlsk181syvnnkekevlvlwgvhhpsniedqktiyrkenayvsvvsshynrrftpeiakrpkvrdq241egrinyywtllepgdtiifeangnliapwyafalsrgfgsgiitsnasmdecdakcqtpq301gainsslpfqnvhpvtigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtg361midgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekr421menlnkkvddgfldiwtynaellvllenertldfhdsnvknlyekvksqlknnakeigng481cfefyhkcnnecmesvkngtydypkyseesklnrekidgvklesmgvyqilaiystvass541lvllvslgaisfwmcsngslqcrici
Comments :
Fetuin Solid Phase, Hemagglutination
Known Sites of Expression :
293T GnT1- cells
External References :
Swissprot : Information not entered/not applicable.
Genbank : ABF47748.1
Experiment Information:
Status: : Public
Title/Project Description: : Continued studies on influenza A virus HA-glycan interactions by testing another set of mutant HA proteins for their ability to bind sialyated glycans, using recombinant, soluble, trimeric HA preparations
Associated Resource Requests: : cfg_rRequest_2211
Glycan Array Version: : PA_v42
Protocol Used: : Protocol Direct Binding
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : Information not entered/not applicable.
Experiment Date [yyyy-mm-dd]: : 2011-01-25
Supplying Investigator : Peter P.J.M Rottier
Specific Assay Information : Sample was precomplexed with antibody: 41 ul Binding Buffer in a tube, added 23.3 ul sample and mixed, added 4.5 ul of anti-Strep mAb (sent by PI) and 1.1 ul Alexa488-labeled anti-mouse IgG (Invitrogen), mixed well, and incubated on ice for 20 minutes. The 7 ug HA precomplex was added to the slide for 2 hours at room temp.
Annotation : Influenza A/Memphis/7/1980 (H1N1)
Protein Sample Analyzed : Influenza A virus A/Memphis/7/1980 H1N1