Glycan Array Experiment: primscreen_3779

Glycan Array ID : primscreen_3779
Sample Name : Burkholderia oklahomensis agglutinin(BOA)
Sample Category : Other
Investigator: : Angela M.  Gronenborn
Download Data:
File: BOA_13581_v5.0_DATA.xls
Conclusive
Sample Information:
Name : Burkholderia oklahomensis agglutinin(BOA)
Complete Name : Information not entered/not applicable.
Family : Viral / Bacterial Lectin
Sub Family : bacterial lectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Burkholderia oklahomensis EO147 proteobacterium
Estimated Purity : >95%
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2011-04-10
Status : Private
Primary Sequence :
svdmtktskgfnnlqhvqnqwggssapwheggmwvlgcrsgqnvvalniksgdggrtltgtmtyvgegpigfratltqsntyavenqwggssapwhpggtwvigcrvnqqvvaldiesgdqgatlagtmtyagegpigfksqqadggvyavenqwggssapwhnggvwvigardqavvavsigstdsgktlngnmtyagegpigfkgnsvagnnyavenqwggtsapwhpggiwllgcrsgqnvvelyitsgdngntfhgsmtysgegpigframalpq
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Expressed in E. coli BL21 DE3 cells; Fish Sci. (2009) 75: 743-753
External References :
Swissprot : Information not entered/not applicable.
Genbank : Information not entered/not applicable.
Experiment Information:
Status: : Public
Title/Project Description: : To investigate binding specificities of the 4-binding-site members of the OAA family (OAA-family lectin from the proteobacterium Burkholderia oklahomensis EO14) for comparison to the rest of the OAA family and other anti-HIV lectins
Associated Resource Requests: : cfg_rRequest_2208
Glycan Array Version: : PA_v5
Protocol Used: : Protocol Direct Binding
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 200 μg/ml
Experiment Date [yyyy-mm-dd]: : 2011-03-17
Supplying Investigator : Angela M.  Gronenborn
Specific Assay Information : Sample was diluted in 25 mM sodium acetate, 25 mM sodium chloride buffer pH 5.0, 4 mM DTT, 1% BSA and was directly labeled with AF488.
Annotation : BOA lectin (MJW)
Protein Sample Analyzed : Burkholderia oklahomensis agglutinin(BOA)