Glycan Array Experiment: primscreen_3975

Glycan Array ID : primscreen_3975
Sample Name : FimH
Sample Category : Other
Investigator: : Lode Wyns
Download Data:
File: FimH_220ug_13847_v5_DATA.xls
Conclusive
Sample Information:
Name : FimH
Complete Name : minor component of type 1 fimbriae
Family : Viral / Bacterial Lectin
Sub Family : I-type lectin, 2-domain fimbrial adhesin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : E. coli
Estimated Purity : 95%
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2010-07-27
Status : Private
Primary Sequence :
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Comments :
Co-crystal structures with specific glycans, SPR, BSI, ITC
Known Sites of Expression :
E. coli, Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin. Bouckaert J, Berglund J, Schembri M, De Genst E, Cools L, Wuhrer M, Hung CS, Pinkner J, Slättegård R, Zavialov A, Choudhury D, Langermann S, Hultgren SJ, Wyns L, Klemm P, Oscarson S, Knight SD, De Greve H. Mol Microbiol. 2005 Jan;55(2):441-55.
External References :
Swissprot : P08191
Genbank : 948847
Experiment Information:
Status: : Public
Title/Project Description: : To identify all glycans that bind specifically to the FimH lectin domain and to determine the affinities for these carbohydrate ligands
Associated Resource Requests: : cfg_rRequest_2323
Glycan Array Version: : PA_v5
Protocol Used: : Protocol Tertiary step
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 220 μg/ml
Experiment Date [yyyy-mm-dd]: : 2011-06-03
Supplying Investigator : Lode Wyns
Specific Assay Information : Sample was detected with anti-FimH antibody followed by Alexa488-labeled anti-rabbit IgG.
Annotation : FimH-220ug
Protein Sample Analyzed : FimH