Glycan Array Experiment: primscreen_5275

Glycan Array ID : primscreen_5275
Sample Name : DC-SIGN
Sample Category : C Type Lectins
Investigator: : Daniel Mitchell
Download Data:
File: Human-DC-Sign-tetramer_15320_v5.0_DATA.xls
Conclusive
Sample Information:
Name : DC-SIGN
Complete Name : CD209 antigen, Dendritic cell-specific ICAM-3-grabbing nonintegrin 1, DC-SIGN1
Family : C-Type Lectin
Sub Family : 2-Type 2 Receptor
Gene Symbol : CD209
Synonyms : CD209 antigen
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-12-09
Status : Public
Primary Sequence :
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Comments :
Information not entered/not applicable.
Known Sites of Expression :
Pooled human melanocyte, fetal heart, and pregnant uterus ;RPE and Choroid ;lens
External References :
Genbank : AF290886
Pdb : 1K9I
Pdb : 1SL4
Pdb : 1SL5
Omim_Parse_Links : 604672
Swissprot : Q9NNX6
Omim : 604672
Pdb : 2B6B
Experiment Information:
Status: : Public
Title/Project Description: : The purpose of this study is to identify and functionally characterize novel humoral and cellular glycan-binding proteins and specific glycan distributions within mammalian species, including tetrameric human DC-SIGN and DC-SIGNR.
Associated Resource Requests: : cfg_rRequest_2569
Glycan Array Version: : PA_v5
Protocol Used: : Protocol Tertiary step
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 200 μg/ml
Experiment Date [yyyy-mm-dd]: : 2012-03-29
Supplying Investigator : Daniel Mitchell
Specific Assay Information : Sample was diluted and detected with anti-DC-Sign/R antibody (sent by PI, used at 2ug/ml in binding buffer) followed by Alexa488-labeled anti-mouse IgG.
Annotation : Human DC-Sign-tetramer
Protein Sample Analyzed : DC-SIGN