Glycan Array Experiment: primscreen_5419

Glycan Array ID : primscreen_5419
Sample Name : Galectin-4
Sample Category : S Type Lectins
Investigator: : Richard D. Cummings
Download Data:
File: Gal-4_9920_20ug_v4.0_DATA.xls
Conclusive
Sample Information:
Name : Galectin-4
Complete Name : Galectin 4, Gal-4, Lactose-binding lectin 4
Family : Galectin
Sub Family : Galectin
Gene Symbol : Lgals4
Synonyms : Information not entered/not applicable.
Species Common Name: : Mouse
Species Scientific Name : Mus musculus
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2004-05-24
Status : Public
Primary Sequence :
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Comments :
Information not entered/not applicable.
Known Sites of Expression :
colon ;pooled organs ;ovary and uterus ;skin ;stomach ;small intestine ;pancreas ;bowel ;blastocyst ;Spleen ;Tcell ;embryo ;cecum ;salivary gland ;liver ;retina ;intestinal mucosa ;mammary gland
External References :
Genbank : BC011236
Swissprot : Q8K419
Experiment Information:
Status: : Public
Title/Project Description: : To determine the specific binding characteristics (both low and high affinity) of biotinylated galectin-4
Associated Resource Requests: : cfg_rRequest_1440
Glycan Array Version: : PA_v4
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 20 μg/ml
Experiment Date [yyyy-mm-dd]: : 2009-03-11
Supplying Investigator : Richard D. Cummings
Specific Assay Information : Sample was diluted in binding buffer plus BME and detected with streptavidin-AF488
Annotation : Human-Gal4-20ug
Protein Sample Analyzed : Galectin-4