Glycan Array Experiment: primscreen_6010

Glycan Array ID : primscreen_6010
Sample Name : Galectin-3
Sample Category : S Type Lectins
Investigator: : Richard D. Cummings
Download Data:
File: Gal-3C-20ug_15157_V5.0_DATA.xls
Conclusive
Sample Information:
Name : Galectin-3
Complete Name : Galectin 3, Gal-3, Galactose-specific lectin 3, Mac-2 antigen, IgE-binding protein, 35 kDa lectin, Carbohydrate binding protein 35, CBP 35, Laminin-binding protein, Lectin L-29, L-31, Galactoside-binding protein, GALBP
Family : Galectin
Sub Family : Galectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Human
Species Scientific Name : Homo sapiens
Estimated Purity : Information not entered/not applicable.
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2003-12-10
Status : Public
Primary Sequence :
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Comments :
Information not entered/not applicable.
Known Sites of Expression :
melanotic melanoma ;colon ;Pooled human melanocyte, fetal heart, and pregnant uterus ;colonic mucosa from 3 patients with Crohn's disease ;large cell carcinoma ;tumor, 5 pooled (see description) ;well-differentiated endometrial adenocarcinoma, 7 pooled tumors ;hepatic adenoma ;ovary ;2 pooled high-grade transitional cell tumors ;Cervix ;lung_tumor ;three pooled meningiomas ;thymus, pooled ;cervical carcinoma cell line ;senescent fibroblast ;adenocarcinoma ;choriocarcinoma ;hypernephroma ;prostate gland ;glioblastoma with EGFR amplification ;primitive neuroectoderm ;Liver and Spleen ;Adrenal gland ;epithelioid carcinoma ;lung_normal ;prostate ;parathyroid tumor ;colon tumor ;melanotic melanoma, high MDR (cell line) ;malignant melanoma, metastatic to lymph node ;glioblastoma (pooled) ;moderately-differentiated adenocarcinoma ;serous papillary carcinoma, high grade, 2 pooled tumors ;renal cell tumor ;anaplastic oligodendroglioma ;large cell carcinoma, undifferentiated ;melanotic melanoma,
External References :
Genbank : BC001120
Pdb : 1A3K
Pdb : 1KJL
Pdb : 1KJR
Omim_Parse_Links : 153619
Swissprot : P17931
Omim : 153619
Experiment Information:
Status: : Public
Title/Project Description: : This request is for the detailed analysis of galectin-3, which has been produced in a bacterial expression system as a full length construct and with an N-terminal deletion that removes the large amino-terminal domain, which may contribute to self-aggregation.
Associated Resource Requests: : cfg_rRequest_2564
Glycan Array Version: : PA_v5
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 20 μg/ml
Experiment Date [yyyy-mm-dd]: : 2012-02-20
Supplying Investigator : Richard D. Cummings
Specific Assay Information : Sample was diluted BB+14mM BME; Sample was detected with streptavidin-AF488.
Annotation : Gal-3C-20ug
Protein Sample Analyzed : Galectin-3